HB (N-Term) anticorps

N° du produit ABIN631771

Cet anticorps Lapin Polyclonal détecte spécifiquement HB dans WB. Il présente une réactivité avec des échantillons de Drosophila melanogaster.

Aperçu rapide pour HB (N-Term) anticorps (ABIN631771)

Antigène: HB

Reactivité: Drosophila melanogaster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Détail du produit

Épitope: N-Term

Specificité: HB antibody was raised against the N terminal Of Hb

Purification: Affinity purified

Immunogène: HB antibody was raised using the N terminal Of Hb corresponding to a region with amino acids MQNWETTATTNYEQHNAWYNSMFAANIKQEPGHHLDGNSVASSPRQSPIP

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HB Blocking Peptide, (ABIN5613938), is also available for use as a blocking control in assays to test for specificity of this HB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: HB

Sujet: Hb is a gap class segmentation protein that controls development of head structures.

Poids moléculaire: 83 kDa (MW of target protein)