KLHL32 anticorps

N° du produit ABIN631778

L’anticorps Lapin Polyclonal anti-KLHL32 a été validé pour WB. Il convient pour détecter KLHL32 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour KLHL32 anticorps (ABIN631778)

Antigène: KLHL32 (Kelch-Like 32 (KLHL32))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KLHL32 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-KLHL32 anticorps

Purification: Affinity purified

Immunogène: KLHL32 antibody was raised using a synthetic peptide corresponding to a region with amino acids DVSREGKEEVFYGPTLPFASNGIAACFLPAPYFTCPNLQTLQVPHHRIGT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KLHL32 Blocking Peptide, (ABIN937611), is also available for use as a blocking control in assays to test for specificity of this KLHL32 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL32 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KLHL32

Antigène: KLHL32 (Kelch-Like 32 (KLHL32))

Autre désignation: KLHL32

Sujet: The specific function of KLHL32 is not yet known.

Poids moléculaire: 70 kDa (MW of target protein)