KLHL32 anticorps

N° du produit ABIN631778

Détail du produit anti-KLHL32 anticorps

Antigène: KLHL32 (Kelch-Like 32 (KLHL32))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KLHL32 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: KLHL32 antibody was raised using a synthetic peptide corresponding to a region with amino acids DVSREGKEEVFYGPTLPFASNGIAACFLPAPYFTCPNLQTLQVPHHRIGT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KLHL32 Blocking Peptide, catalog no. 33R-2225, is also available for use as a blocking control in assays to test for specificity of this KLHL32 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL32 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KLHL32

Antigène: KLHL32 (Kelch-Like 32 (KLHL32))

Autre désignation: KLHL32 (KLHL32 Produits)

Synonymes: anticorps 6430524H05Rik, anticorps D4Ertd389e, anticorps Gm1356, anticorps mKIAA1900, anticorps zgc:158866, anticorps BKLHD5, anticorps KIAA1900, anticorps UG0030H05, anticorps dJ21F7.1, anticorps RGD1310364, anticorps kelch like family member 32, anticorps kelch-like 32, anticorps kelch-like family member 32, anticorps kelch like family member 32 L homeolog, anticorps KLHL32, anticorps Klhl32, anticorps klhl32, anticorps klhl32.L

Sujet: The specific function of KLHL32 is not yet known.

Poids moléculaire: 70 kDa (MW of target protein)