UCHL5 anticorps (Middle Region)
-
- Antigène Voir toutes UCHL5 Anticorps
- UCHL5 (Ubiquitin Carboxyl-terminal Hydrolase L5 (UCHL5))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp UCHL5 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- UCHL5 antibody was raised against the middle region of UCHL5
- Purification
- Affinity purified
- Immunogène
- UCHL5 antibody was raised using the middle region of UCHL5 corresponding to a region with amino acids DGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRK
- Top Product
- Discover our top product UCHL5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
UCHL5 Blocking Peptide, catalog no. 33R-1959, is also available for use as a blocking control in assays to test for specificity of this UCHL5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UCHL5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- UCHL5 (Ubiquitin Carboxyl-terminal Hydrolase L5 (UCHL5))
- Autre désignation
- UCHL5 (UCHL5 Produits)
- Synonymes
- anticorps zgc:85615, anticorps wu:fj17f09, anticorps uch37, anticorps cgi-70, anticorps DKFZp459M0513, anticorps 5830413B11Rik, anticorps Uch37, anticorps CGI-70, anticorps INO80R, anticorps UCH-L5, anticorps UCH37, anticorps ubiquitin carboxyl-terminal hydrolase L5, anticorps ubiquitin C-terminal hydrolase L5, anticorps ubiquitin C-terminal hydrolase L5 L homeolog, anticorps ubiquitin carboxyl-terminal esterase L5, anticorps uchl5, anticorps UCHL5, anticorps uchl5.L, anticorps Uchl5
- Sujet
- UCHL5 is the deubiquitinating enzyme associated with the proteasome.
- Poids moléculaire
- 37 kDa (MW of target protein)
-