UCHL5 anticorps (Middle Region)

N° du produit ABIN631781

L’anticorps anti-UCHL5 Polyclonal Lapin est utilisé pour la détection de UCHL5 dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB.

Aperçu rapide pour UCHL5 anticorps (Middle Region) (ABIN631781)

Antigène: UCHL5 (Ubiquitin Carboxyl-terminal Hydrolase L5 (UCHL5))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UCHL5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-UCHL5 anticorps

Épitope: Middle Region

Specificité: UCHL5 antibody was raised against the middle region of UCHL5

Purification: Affinity purified

Immunogène: UCHL5 antibody was raised using the middle region of UCHL5 corresponding to a region with amino acids DGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UCHL5 Blocking Peptide, (ABIN937345), is also available for use as a blocking control in assays to test for specificity of this UCHL5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UCHL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UCHL5

Antigène: UCHL5 (Ubiquitin Carboxyl-terminal Hydrolase L5 (UCHL5))

Autre désignation: UCHL5

Sujet: UCHL5 is the deubiquitinating enzyme associated with the proteasome.

Poids moléculaire: 37 kDa (MW of target protein)