YTHDF3 anticorps (N-Term)

N° du produit ABIN631782

Détail du produit anti-YTHDF3 anticorps

Antigène: YTHDF3 (YTH Domain Family, Member 3 (YTHDF3))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp YTHDF3 est non-conjugé

Application: Western Blotting (WB)

Specificité: YTHDF3 antibody was raised against the N terminal of YTHDF3

Purification: Affinity purified

Immunogène: YTHDF3 antibody was raised using the N terminal of YTHDF3 corresponding to a region with amino acids QPGALGNTPPFLGQHGFNFFPGNADFSTWGTSGSQGQSTQSSAYSSSYGY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

YTHDF3 Blocking Peptide, catalog no. 33R-7676, is also available for use as a blocking control in assays to test for specificity of this YTHDF3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of YTHDF3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur YTHDF3

Antigène: YTHDF3 (YTH Domain Family, Member 3 (YTHDF3))

Autre désignation: YTHDF3 (YTHDF3 Produits)

Synonymes: anticorps wu:fi35c09, anticorps zgc:55441, anticorps 9130022A11Rik, anticorps YTH N6-methyladenosine RNA binding protein 3, anticorps YTH N(6)-methyladenosine RNA binding protein 3, anticorps YTH domain family 3, anticorps YTH N6-methyladenosine RNA binding protein 3 S homeolog, anticorps ythdf3, anticorps YTHDF3, anticorps Ythdf3, anticorps ythdf3.S

Sujet: YTHDF3 contains 1 YTH domain. The functions of YTHDF3 remain unknown.

Poids moléculaire: 64 kDa (MW of target protein)