RPL10A anticorps (Middle Region)

N° du produit ABIN631783

Détail du produit anti-RPL10A anticorps

Antigène: RPL10A (Ribosomal Protein L10a (RPL10A))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPL10A est non-conjugé

Application: Western Blotting (WB)

Specificité: RPL10 A antibody was raised against the middle region of RPL10

Purification: Affinity purified

Immunogène: RPL10 A antibody was raised using the middle region of RPL10 corresponding to a region with amino acids YDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPL10A Blocking Peptide, catalog no. 33R-10063, is also available for use as a blocking control in assays to test for specificity of this RPL10A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPL10A

Antigène: RPL10A (Ribosomal Protein L10a (RPL10A))

Autre désignation: RPL10A (RPL10A Produits)

Synonymes: anticorps Csa-19, anticorps L10A, anticorps NEDD6, anticorps CsA-19, anticorps Nedd6, anticorps wu:fb94f08, anticorps zgc:73082, anticorps zgc:86881, anticorps ribosomal protein L10a, anticorps ribosomal protein L10A, anticorps ribosomal protein L10a S homeolog, anticorps RPL10A, anticorps Rpl10a, anticorps rpl10a, anticorps rpl10a.S

Sujet: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L1P family of ribosomal proteins. It is located in the cytoplasm.

Poids moléculaire: 25 kDa (MW of target protein)