CRBN anticorps (N-Term)

N° du produit ABIN631784

L’anticorps anti-CRBN Polyclonal produit chez le Lapin a été validé pour WB. Il convient pour la détection de CRBN dans des échantillons provenant de Humain. }

Aperçu rapide pour CRBN anticorps (N-Term) (ABIN631784)

Antigène: CRBN (Cereblon (CRBN))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CRBN est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CRBN anticorps

Épitope: N-Term

Specificité: CRBN antibody was raised against the N terminal of CRBN

Purification: Affinity purified

Immunogène: CRBN antibody was raised using the N terminal of CRBN corresponding to a region with amino acids DQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CRBN Blocking Peptide, (ABIN937511), is also available for use as a blocking control in assays to test for specificity of this CRBN antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRBN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CRBN

Antigène: CRBN (Cereblon (CRBN))

Autre désignation: CRBN

Sujet: This gene encodes a protein related to the Lon protease protein family. In rodents and other mammals this gene product is found in the cytoplasm localized with a calcium channel membrane protein, and is thought to play a role in brain development.

Poids moléculaire: 50 kDa (MW of target protein)