POC1B anticorps (N-Term)
-
- Antigène Voir toutes POC1B Anticorps
- POC1B (POC1 Centriolar Protein Homolog B (POC1B))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp POC1B est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- WDR51 B antibody was raised against the N terminal of WDR51
- Purification
- Affinity purified
- Immunogène
- WDR51 B antibody was raised using the N terminal of WDR51 corresponding to a region with amino acids GNLLASASRDRTVRLWIPDKRGKFSEFKAHTAPVRSVDFSADGQFLATAS
- Top Product
- Discover our top product POC1B Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
WDR51B Blocking Peptide, catalog no. 33R-3452, is also available for use as a blocking control in assays to test for specificity of this WDR51B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR50 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- POC1B (POC1 Centriolar Protein Homolog B (POC1B))
- Autre désignation
- WDR51B (POC1B Produits)
- Sujet
- WDR51B contains 7 WD repeats. The function of the WDR51B protein remains unknown.
- Poids moléculaire
- 54 kDa (MW of target protein)
-