ALOX12 anticorps (C-Term)

N° du produit ABIN631808

L’anticorps Lapin Polyclonal anti-ALOX12 a été validé pour WB. Il convient pour détecter ALOX12 dans des échantillons de Humain.

Aperçu rapide pour ALOX12 anticorps (C-Term) (ABIN631808)

Antigène: ALOX12 (Arachidonate 12-Lipoxygenase (ALOX12))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALOX12 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ALOX12 anticorps

Épitope: C-Term

Specificité: ALOX12 antibody was raised against the C terminal of ALOX12

Purification: Affinity purified

Immunogène: ALOX12 antibody was raised using the C terminal of ALOX12 corresponding to a region with amino acids MGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ALOX12 Blocking Peptide, (ABIN5612028), is also available for use as a blocking control in assays to test for specificity of this ALOX12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALOX12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ALOX12

Antigène: ALOX12 (Arachidonate 12-Lipoxygenase (ALOX12))

Autre désignation: ALOX12

Sujet: ALOX12 belongs to the lipoxygenase family. It contains 1 lipoxygenase domain and 1 PLAT domain. It has oxygenase and 14,15-leukotriene A4 synthase activity.

Poids moléculaire: 76 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity