ALOX12 anticorps (C-Term)
-
- Antigène Voir toutes ALOX12 Anticorps
- ALOX12 (Arachidonate 12-Lipoxygenase (ALOX12))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ALOX12 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ALOX12 antibody was raised against the C terminal of ALOX12
- Purification
- Affinity purified
- Immunogène
- ALOX12 antibody was raised using the C terminal of ALOX12 corresponding to a region with amino acids MGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQF
- Top Product
- Discover our top product ALOX12 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ALOX12 Blocking Peptide, catalog no. 33R-6077, is also available for use as a blocking control in assays to test for specificity of this ALOX12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALOX12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ALOX12 (Arachidonate 12-Lipoxygenase (ALOX12))
- Autre désignation
- ALOX12 (ALOX12 Produits)
- Synonymes
- anticorps 15-LOX-1, anticorps 15LOX-1, anticorps 12-LOX, anticorps 12S-LOX, anticorps LOG12, anticorps ALOX12, anticorps ALOX15, anticorps 9930022G08Rik, anticorps Alox12p, anticorps P-12LO, anticorps 12-LO, anticorps zgc:64120, anticorps wu:fb72a11, anticorps arachidonate 15-lipoxygenase, anticorps arachidonate 12-lipoxygenase, 12S type, anticorps arachidonate 12-lipoxygenase, anticorps arachidonate 12-lipoxygenase, 12S-type, anticorps ALOX15, anticorps ALOX12, anticorps Alox12, anticorps alox12, anticorps LOC100072916
- Sujet
- ALOX12 belongs to the lipoxygenase family. It contains 1 lipoxygenase domain and 1 PLAT domain. It has oxygenase and 14,15-leukotriene A4 synthase activity.
- Poids moléculaire
- 76 kDa (MW of target protein)
- Pathways
- Positive Regulation of Endopeptidase Activity
-