MPV17L anticorps (N-Term)

N° du produit ABIN631809

Détail du produit anti-MPV17L anticorps

Antigène: MPV17L (MPV17 Mitochondrial Membrane Protein-Like (MPV17L))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MPV17L est non-conjugé

Application: Western Blotting (WB)

Specificité: MPV17 L antibody was raised against the N terminal of MPV17

Purification: Affinity purified

Immunogène: MPV17 L antibody was raised using the N terminal of MPV17 corresponding to a region with amino acids MAGWWPALSRAARRHPWPTNVLLYGSLVSAGDALQQRLQGREANWRQTRR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MPV17L Blocking Peptide, catalog no. 33R-5673, is also available for use as a blocking control in assays to test for specificity of this MPV17L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPV10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MPV17L

Antigène: MPV17L (MPV17 Mitochondrial Membrane Protein-Like (MPV17L))

Autre désignation: MPV17L (MPV17L Produits)

Synonymes: anticorps Mpv17, anticorps M-LPH, anticorps MLPH1, anticorps MLPH2, anticorps MPV17L1, anticorps M-LP, anticorps MpV17 mitochondrial inner membrane protein, anticorps MPV17 mitochondrial membrane protein-like S homeolog, anticorps mpv17-like protein, anticorps MPV17 mitochondrial membrane protein-like, anticorps MPV17 mitochondrial inner membrane protein like, anticorps Mpv17 transgene, kidney disease mutant-like, anticorps Mpv17, anticorps mpv17l.S, anticorps LOC465114, anticorps LOC100158680, anticorps MPV17L, anticorps Mpv17l

Sujet: Isoform 1 participates in reactive oxygen species metablism by up- or down-regulation of the genes of antioxidant enzymes.

Poids moléculaire: 17 kDa (MW of target protein)

Pathways: Sensory Perception of Sound