RAD17 anticorps

N° du produit ABIN631819

Détail du produit anti-RAD17 anticorps

Antigène: RAD17

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAD17 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: RAD17 antibody was raised using a synthetic peptide corresponding to a region with amino acids MNQVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLESSRF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAD17 Blocking Peptide, catalog no. 33R-6262, is also available for use as a blocking control in assays to test for specificity of this RAD17 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD17 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAD17

Antigène: RAD17

Autre désignation: RAD17 (RAD17 Produits)

Synonymes: anticorps zgc:91969, anticorps RAD17, anticorps K2A18.21, anticorps K2A18_21, anticorps RADIATION SENSITIVE 17, anticorps CCYC, anticorps HRAD17, anticorps R24L, anticorps RAD17SP, anticorps RAD24, anticorps 9430035O09Rik, anticorps MmRad24, anticorps RAD17 checkpoint clamp loader component, anticorps Rad17p, anticorps RADIATION SENSITIVE 17, anticorps RAD17, anticorps rad17, anticorps ATRAD17, anticorps Rad17

Sujet: RAD17 is highly similar to the gene product of Schizosaccharomyces pombe rad17, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein shares strong similarity with DNA replication factor C (RFC), and can form a complex with RFCs.

Poids moléculaire: 76 kDa (MW of target protein)