FBXW10 anticorps (N-Term)
-
- Antigène Voir toutes FBXW10 Anticorps
- FBXW10 (F-Box and WD Repeat Domain Containing 10 (FBXW10))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FBXW10 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FBXW10 antibody was raised against the N terminal of FBXW10
- Purification
- Affinity purified
- Immunogène
- FBXW10 antibody was raised using the N terminal of FBXW10 corresponding to a region with amino acids SPEKDHSSKSATSQVYWTAKTQHTSLPLSKAPENEHLLGAASNPEEPWRN
- Top Product
- Discover our top product FBXW10 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FBXW10 Blocking Peptide, catalog no. 33R-8670, is also available for use as a blocking control in assays to test for specificity of this FBXW10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXW10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FBXW10 (F-Box and WD Repeat Domain Containing 10 (FBXW10))
- Autre désignation
- FBXW10 (FBXW10 Produits)
- Sujet
- Members of the F-box protein family, such as FBXW10, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.
- Poids moléculaire
- 120 kDa (MW of target protein)
-