ANKLE2 anticorps (Middle Region)

N° du produit ABIN631827

Cet anticorps anti-ANKLE2 Polyclonal Lapin (ABIN631827) détecte spécifiquement ANKLE2 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour ANKLE2 anticorps (Middle Region) (ABIN631827)

Antigène: ANKLE2 (Ankyrin Repeat and LEM Domain Containing 2 (ANKLE2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ANKLE2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ANKLE2 anticorps

Épitope: Middle Region

Specificité: KIAA0692 antibody was raised against the middle region of Kiaa0692

Purification: Affinity purified

Immunogène: KIAA0692 antibody was raised using the middle region of Kiaa0692 corresponding to a region with amino acids CYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKPGLG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIAA0692 Blocking Peptide, (ABIN937225), is also available for use as a blocking control in assays to test for specificity of this KIAA0692 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0692 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ANKLE2

Antigène: ANKLE2 (Ankyrin Repeat and LEM Domain Containing 2 (ANKLE2))

Autre désignation: KIAA0692

Sujet: KIAA0692 is a single-pass membrane protein. It contains 1 ANK repeat and 1 LEM domain. It contains 1 RING-type zinc finger. The function of KIAA0692 remains unknown.

Poids moléculaire: 104 kDa (MW of target protein)