ANKLE2 anticorps (Middle Region)
-
- Antigène Tous les produits ANKLE2
- ANKLE2 (Ankyrin Repeat and LEM Domain Containing 2 (ANKLE2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ANKLE2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KIAA0692 antibody was raised against the middle region of Kiaa0692
- Purification
- Affinity purified
- Immunogène
- KIAA0692 antibody was raised using the middle region of Kiaa0692 corresponding to a region with amino acids CYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKPGLG
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KIAA0692 Blocking Peptide, catalog no. 33R-1839, is also available for use as a blocking control in assays to test for specificity of this KIAA0692 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0692 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ANKLE2 (Ankyrin Repeat and LEM Domain Containing 2 (ANKLE2))
- Autre désignation
- KIAA0692 (ANKLE2 Produits)
- Synonymes
- anticorps KIAA0692, anticorps LEMD7, anticorps Lem4, anticorps 1110001J12Rik, anticorps AI661024, anticorps D5Ertd585e, anticorps RGD1310191, anticorps ankyrin repeat and LEM domain containing 2, anticorps ANKLE2, anticorps Ankle2
- Sujet
- KIAA0692 is a single-pass membrane protein. It contains 1 ANK repeat and 1 LEM domain. It contains 1 RING-type zinc finger. The function of KIAA0692 remains unknown.
- Poids moléculaire
- 104 kDa (MW of target protein)
-