Sec23 Homolog B anticorps

N° du produit ABIN631828

Cet anticorps Lapin Polyclonal détecte spécifiquement Sec23 Homolog B dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour Sec23 Homolog B anticorps (ABIN631828)

Antigène: Sec23 Homolog B (SEC23B)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Sec23 Homolog B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Sec23 Homolog B anticorps

Purification: Affinity purified

Immunogène: SEC23 B antibody was raised using a synthetic peptide corresponding to a region with amino acids SFSLYPQFMFHLRRSPFLQVFNNSPDESSYYRHHFARQDLTQSLIMIQPI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SEC23B Blocking Peptide, (ABIN5616029), is also available for use as a blocking control in assays to test for specificity of this SEC23B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEC20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Sec23 Homolog B

Antigène: Sec23 Homolog B (SEC23B)

Autre désignation: SEC23B

Sujet: SEC23B is a member of the SEC23 subfamily of the SEC23/SEC24 family, which is involved in vesicle trafficking. SEC23B has similarity to yeast Sec23p component of COPII. COPII is the coat protein complex responsible for vesicle budding from the ER. The function SEC23B has been implicated in cargo selection and concentration.

Poids moléculaire: 86 kDa (MW of target protein)