Sec23 Homolog B anticorps

N° du produit ABIN631828

Détail du produit anti-Sec23 Homolog B anticorps

Antigène: Sec23 Homolog B (SEC23B)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Sec23 Homolog B est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SEC23 B antibody was raised using a synthetic peptide corresponding to a region with amino acids SFSLYPQFMFHLRRSPFLQVFNNSPDESSYYRHHFARQDLTQSLIMIQPI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SEC23B Blocking Peptide, catalog no. 33R-8439, is also available for use as a blocking control in assays to test for specificity of this SEC23B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEC20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Sec23 Homolog B

Antigène: Sec23 Homolog B (SEC23B)

Autre désignation: SEC23B (SEC23B Produits)

Synonymes: anticorps CDA-II, anticorps CDAII, anticorps CDAN2, anticorps HEMPAS, anticorps wu:fd19h01, anticorps wu:fl08h02, anticorps zgc:55595, anticorps zgc:86871, anticorps SEC23A, anticorps Sec23 homolog B, COPII coat complex component L homeolog, anticorps Sec23 homolog B, coat complex II component, anticorps Sec23 homolog B, COPII coat complex component, anticorps SEC23 homolog B, COPII coat complex component, anticorps sec23b.L, anticorps SEC23B, anticorps sec23b, anticorps Sec23b

Sujet: SEC23B is a member of the SEC23 subfamily of the SEC23/SEC24 family, which is involved in vesicle trafficking. SEC23B has similarity to yeast Sec23p component of COPII. COPII is the coat protein complex responsible for vesicle budding from the ER. The function SEC23B has been implicated in cargo selection and concentration.

Poids moléculaire: 86 kDa (MW of target protein)