NOP16 anticorps (Middle Region)

N° du produit ABIN631833

Détail du produit anti-NOP16 anticorps

Antigène: NOP16 (Nucleolar Protein 16 (NOP16))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NOP16 est non-conjugé

Application: Western Blotting (WB)

Specificité: HSPC111 antibody was raised against the middle region of HSPC111

Purification: Affinity purified

Immunogène: HSPC111 antibody was raised using the middle region of HSPC111 corresponding to a region with amino acids RKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HSPC111 Blocking Peptide, catalog no. 33R-8012, is also available for use as a blocking control in assays to test for specificity of this HSPC111 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPC111 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NOP16

Antigène: NOP16 (Nucleolar Protein 16 (NOP16))

Autre désignation: HSPC111 (NOP16 Produits)

Synonymes: anticorps zgc:92910, anticorps HSPC111, anticorps HSPC185, anticorps AA409471, anticorps D13Wsu177e, anticorps RGD1305727, anticorps NOP16 nucleolar protein homolog (yeast), anticorps 66S preribosome component NOP16, anticorps NOP16 nucleolar protein, anticorps NOP16 nucleolar protein S homeolog, anticorps hypothetical protein, anticorps nop16, anticorps ANI_1_620034, anticorps BDBG_00770, anticorps AOR_1_1422114, anticorps TERG_00604, anticorps NOP16, anticorps Nop16, anticorps nop16.S, anticorps CAALFM_C209660WA

Sujet: NOP16 is transcriptionally regulated by c-Myc, upregulated in breast cancer, and overexpression is associated with poor patient survival.

Poids moléculaire: 21 kDa (MW of target protein)