PYROXD2 anticorps (N-Term)

N° du produit ABIN631834

Détail du produit anti-PYROXD2 anticorps

Antigène: PYROXD2 (C10ORF33) (Chromosome 10 Open Reading Frame 33 (C10ORF33))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PYROXD2 est non-conjugé

Application: Western Blotting (WB)

Specificité: C10 ORF33 antibody was raised against the N terminal Of C10 rf33

Purification: Affinity purified

Immunogène: C10 ORF33 antibody was raised using the N terminal Of C10 rf33 corresponding to a region with amino acids MAASGRGLCKAVAASPFPAWRRDNTEARGGLKPEYDAVVIGAGHNGLVAA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C10ORF33 Blocking Peptide, catalog no. 33R-5610, is also available for use as a blocking control in assays to test for specificity of this C10ORF33 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF33 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PYROXD2

Antigène: PYROXD2 (C10ORF33) (Chromosome 10 Open Reading Frame 33 (C10ORF33))

Autre désignation: C10ORF33 (C10ORF33 Produits)

Synonymes: anticorps C10orf33, anticorps DKFZp469H0233, anticorps FP3420, anticorps C26H10orf33, anticorps 3830409H07Rik, anticorps 4833409A17Rik, anticorps RGD1303232, anticorps pyridine nucleotide-disulphide oxidoreductase domain 2, anticorps PYROXD2, anticorps Pyroxd2

Sujet: C10orf33 is probably involved in oxidoreductase activity.

Poids moléculaire: 63 kDa (MW of target protein)