PRRC1 anticorps (Middle Region)

N° du produit ABIN631835

L’anticorps Lapin Polyclonal anti-PRRC1 a été validé pour WB. Il convient pour détecter PRRC1 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour PRRC1 anticorps (Middle Region) (ABIN631835)

Antigène: PRRC1 (Proline-Rich Coiled-Coil 1 (PRRC1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRRC1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PRRC1 anticorps

Épitope: Middle Region

Specificité: PRRC1 antibody was raised against the middle region of PRRC1

Purification: Affinity purified

Immunogène: PRRC1 antibody was raised using the middle region of PRRC1 corresponding to a region with amino acids VGEAGQSNIAPQPVGYAAGLKGAQERIDSLRRTGVIHEKQTAVSVENFIA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRRC1 Blocking Peptide, (ABIN5615596), is also available for use as a blocking control in assays to test for specificity of this PRRC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRRC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRRC1

Antigène: PRRC1 (Proline-Rich Coiled-Coil 1 (PRRC1))

Autre désignation: PRRC1

Sujet: The specific function of PRRC1 is not yet known.

Poids moléculaire: 47 kDa (MW of target protein)