DCXR anticorps (Middle Region)

N° du produit ABIN631837

Cet anticorps Lapin Polyclonal détecte spécifiquement DCXR dans WB et IHC. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour DCXR anticorps (Middle Region) (ABIN631837)

Antigène: DCXR (Dicarbonyl/L-Xylulose Reductase (DCXR))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DCXR est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-DCXR anticorps

Épitope: Middle Region

Specificité: DCXR antibody was raised against the middle region of DCXR

Purification: Affinity purified

Immunogène: DCXR antibody was raised using the middle region of DCXR corresponding to a region with amino acids STKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTM

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DCXR Blocking Peptide, (ABIN5613147), is also available for use as a blocking control in assays to test for specificity of this DCXR antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCXR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DCXR

Antigène: DCXR (Dicarbonyl/L-Xylulose Reductase (DCXR))

Autre désignation: DCXR

Sujet: DCXR is an enzyme that has both diacetyl reductase and L-xylulose reductase activities.DCXR is an enzyme that has both diacetyl reductase (EC 1.1.1.5) and L-xylulose reductase (EC 1.1.1.10) activities.

Poids moléculaire: 27 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process, Monocarboxylic Acid Catabolic Process