ENKD1 anticorps (C-Term)

N° du produit ABIN631839

Détail du produit anti-ENKD1 anticorps

Antigène: ENKD1 (Enkurin Domain Containing 1 (ENKD1))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ENKD1 est non-conjugé

Application: Western Blotting (WB)

Specificité: C16 ORF48 antibody was raised against the C terminal Of C16 rf48

Purification: Affinity purified

Immunogène: C16 ORF48 antibody was raised using the C terminal Of C16 rf48 corresponding to a region with amino acids DLWRREAEARKQSQPDPAMPPGHTRMPENQRLETLTKLLQSQSQLLRELV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C16ORF48 Blocking Peptide, catalog no. 33R-2073, is also available for use as a blocking control in assays to test for specificity of this C16ORF48 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF48 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ENKD1

Antigène: ENKD1 (Enkurin Domain Containing 1 (ENKD1))

Autre désignation: C16ORF48 (ENKD1 Produits)

Synonymes: anticorps C16orf48, anticorps DAKV6410, anticorps C18H16orf48, anticorps AI606951, anticorps E130303B06Rik, anticorps enkurin domain containing 1, anticorps ENKD1, anticorps Enkd1

Sujet: The function of C16orf48 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 39 kDa (MW of target protein)