C7orf31 anticorps (N-Term)

N° du produit ABIN631840

Cet anticorps Lapin Polyclonal détecte spécifiquement C7orf31 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour C7orf31 anticorps (N-Term) (ABIN631840)

Antigène: C7orf31 (Chromosome 7 Open Reading Frame 31 (C7orf31))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C7orf31 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-C7orf31 anticorps

Épitope: N-Term

Specificité: C7 ORF31 antibody was raised against the N terminal Of C7 rf31

Purification: Affinity purified

Immunogène: C7 ORF31 antibody was raised using the N terminal Of C7 rf31 corresponding to a region with amino acids EVIHGRPYCCRELEGADILSNTFYSNELHNPLQTVTRPTASEDRYQELRE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C7ORF31 Blocking Peptide, (ABIN938175), is also available for use as a blocking control in assays to test for specificity of this C7ORF31 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF31 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C7orf31

Antigène: C7orf31 (Chromosome 7 Open Reading Frame 31 (C7orf31))

Autre désignation: C7ORF31

Sujet: The function of C7orf31 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 68 kDa (MW of target protein)