SKA3 anticorps (Middle Region)

N° du produit ABIN631843

Détail du produit anti-SKA3 anticorps

Antigène: SKA3 (Spindle and Kinetochore Associated Complex Subunit 3 (SKA3))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SKA3 est non-conjugé

Application: Western Blotting (WB)

Specificité: SKA3 antibody was raised against the middle region of SKA3

Purification: Affinity purified

Immunogène: SKA3 antibody was raised using the middle region of SKA3 corresponding to a region with amino acids EVEDRTSLVLNSDTCFENLTDPSSPTISSYENLLRTPTPPEVTKIPEDIL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SKA3 Blocking Peptide, catalog no. 33R-2779, is also available for use as a blocking control in assays to test for specificity of this SKA3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SKA3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SKA3

Antigène: SKA3 (Spindle and Kinetochore Associated Complex Subunit 3 (SKA3))

Autre désignation: SKA3 (SKA3 Produits)

Synonymes: anticorps C13orf3, anticorps RAMA1, anticorps RGD1307201, anticorps C12H13ORF3, anticorps fc23d11, anticorps si:rp71-68n21.13, anticorps wu:fc23d11, anticorps rama1, anticorps F630043A04Rik, anticorps spindle and kinetochore associated complex subunit 3, anticorps spindle and kinetochore associated complex subunit 3 L homeolog, anticorps SKA3, anticorps Ska3, anticorps ska3, anticorps ska3.L

Sujet: This protein is a component of the spindle and kinetochore-associated protein complex that regulates microtubule attachment to the kinetochores during mitosis. The encoded protein localizes to the outer kinetechore and may be required for normal chromosome segregation and cell division. Alternative splicing results in multiple transcript variants.

Poids moléculaire: 46 kDa (MW of target protein)