GNPDA1 anticorps (C-Term)

N° du produit ABIN631844

Détail du produit anti-GNPDA1 anticorps

Antigène: GNPDA1 (Glucosamine-6-Phosphate Deaminase 1 (GNPDA1))

Épitope: C-Term

Reactivité: Souris, Humain, Rat, C. elegans

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GNPDA1 est non-conjugé

Application: Western Blotting (WB)

Specificité: GNPDA1 antibody was raised against the C terminal of GNPDA1

Purification: Affinity purified

Immunogène: GNPDA1 antibody was raised using the C terminal of GNPDA1 corresponding to a region with amino acids EGVNHMWTVSAFQQHPRTVFVCDEDATLELKVKTVKYFKGLMLVHNKLVD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GNPDA1 Blocking Peptide, catalog no. 33R-2449, is also available for use as a blocking control in assays to test for specificity of this GNPDA1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNPDA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GNPDA1

Antigène: GNPDA1 (Glucosamine-6-Phosphate Deaminase 1 (GNPDA1))

Autre désignation: GNPDA1 (GNPDA1 Produits)

Synonymes: anticorps GNP1, anticorps GNPDA, anticorps GNPI, anticorps GPI, anticorps HLN, anticorps Gnp1, anticorps Gnpi, anticorps oscillin, anticorps gnpda, anticorps gnpi, anticorps gpi, anticorps hln, anticorps GNPDA1, anticorps zgc:110691, anticorps glucosamine-6-phosphate deaminase 1, anticorps glucosamine-6-phosphate deaminase 1 S homeolog, anticorps Glucosamine-6-phosphate deaminase 1, anticorps GNPDA1, anticorps Gnpda1, anticorps gnpda1.S, anticorps gnpda1, anticorps MSMEG_0501, anticorps nagB, anticorps PPSC2_c4268

Sujet: GNPDA1 belongs to the glucosamine/galactosamine-6-phosphate isomerase family.It seems to trigger calcium oscillations in mammalian eggs. These oscillations serve as the essential trigger for egg activation and early development of the embryo.

Poids moléculaire: 33 kDa (MW of target protein)