THOC6 anticorps

N° du produit ABIN631845

Cet anticorps anti-THOC6 est un anticorps Lapin Polyclonal détectant THOC6 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour THOC6 anticorps (ABIN631845)

Antigène: THOC6 (THO Complex 6 Homolog (THOC6))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp THOC6 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-THOC6 anticorps

Purification: Affinity purified

Immunogène: THOC6 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGGDCQLHTMDLETGTFTRVLRGHTDYIHCLALRERSPEVLSGGEDGAVR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

THOC6 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this THOC6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THOC6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur THOC6

Antigène: THOC6 (THO Complex 6 Homolog (THOC6))

Autre désignation: THOC6

Sujet: THOC6 belongs to the WD repeat THOC6 family.It contains 7 WD repeats. The function of the THOC6 protein remains unknown.

Poids moléculaire: 37 kDa (MW of target protein)