CPN2 anticorps (N-Term)

N° du produit ABIN631849

Cet anticorps Lapin Polyclonal détecte spécifiquement CPN2 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour CPN2 anticorps (N-Term) (ABIN631849)

Antigène: CPN2 (Carboxypeptidase N Subunit 2 (CPN2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CPN2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CPN2 anticorps

Épitope: N-Term

Specificité: Carboxypeptidase N2 antibody was raised against the N terminal of CPN2

Purification: Affinity purified

Immunogène: Carboxypeptidase N2 antibody was raised using the N terminal of CPN2 corresponding to a region with amino acids FTTLETRAFGSNPNLTKVVFLNTQLCQFRPDAFGGLPRLEDLEVTGSSFL

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Carboxypeptidase N2 Blocking Peptide, (ABIN938489), is also available for use as a blocking control in assays to test for specificity of this Carboxypeptidase N2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CPN2

Antigène: CPN2 (Carboxypeptidase N Subunit 2 (CPN2))

Autre désignation: Carboxypeptidase N2

Sujet: CPN2 contains 13 LRR (leucine-rich) repeats. The 83 kDa subunit binds and stabilizes the catalytic subunit at 37 degrees Celsius and keeps it in circulation. Under some circumstances it may be an allosteric modifier of the catalytic subunit.

Poids moléculaire: 60 kDa (MW of target protein)