RFPL2 anticorps (C-Term)

N° du produit ABIN631850

Détail du produit anti-RFPL2 anticorps

Antigène: RFPL2 (Ret Finger Protein-Like 2 (RFPL2))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RFPL2 est non-conjugé

Application: Western Blotting (WB)

Specificité: RFPL2 antibody was raised against the C terminal of RFPL2

Purification: Affinity purified

Immunogène: RFPL2 antibody was raised using the C terminal of RFPL2 corresponding to a region with amino acids VSFFDAESGSHVYTFRSVSAEEPLRPFLAPSVPPNGDQGVLSICPLMNSG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RFPL2 Blocking Peptide, catalog no. 33R-9802, is also available for use as a blocking control in assays to test for specificity of this RFPL2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFPL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RFPL2

Antigène: RFPL2 (Ret Finger Protein-Like 2 (RFPL2))

Autre désignation: RFPL2 (RFPL2 Produits)

Synonymes: anticorps RNF79, anticorps RFPL2, anticorps ret finger protein like 2, anticorps ret finger protein-like 2, anticorps ret finger protein-like 3, anticorps RFPL2, anticorps LOC470188, anticorps LOC100601334

Sujet: RFPL2 contains 1 B30.2/SPRY domain and 1 RING-type zinc finger. The human RFPL2 gene has a role in neocortex development.

Poids moléculaire: 32 kDa (MW of target protein)