ALS2CR12 anticorps

N° du produit ABIN631852

Cet anticorps Lapin Polyclonal détecte spécifiquement ALS2CR12 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour ALS2CR12 anticorps (ABIN631852)

Antigène: ALS2CR12 (Amyotrophic Lateral Sclerosis 2 (Juvenile) Chromosome Region, Candidate 12 (ALS2CR12))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALS2CR12 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ALS2CR12 anticorps

Purification: Affinity purified

Immunogène: ALS2 CR12 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSKLTPLVPAPKNHNYLQPTKPVVSPKMKIHSARQEETNKSFYEVINVSP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ALS2CR12 Blocking Peptide, (ABIN5612041), is also available for use as a blocking control in assays to test for specificity of this ALS2CR12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALS0 R12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ALS2CR12

Antigène: ALS2CR12 (Amyotrophic Lateral Sclerosis 2 (Juvenile) Chromosome Region, Candidate 12 (ALS2CR12))

Autre désignation: ALS2CR12

Sujet: The function of ALS2CR12 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 52 kDa (MW of target protein)