AASDH anticorps (Middle Region)

N° du produit ABIN631854

Cet anticorps anti-AASDH est un anticorps Lapin Polyclonal détectant AASDH dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour AASDH anticorps (Middle Region) (ABIN631854)

Antigène: AASDH (Aminoadipate-Semialdehyde Dehydrogenase (AASDH))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AASDH est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-AASDH anticorps

Épitope: Middle Region

Specificité: AASDH antibody was raised against the middle region of AASDH

Purification: Affinity purified

Immunogène: AASDH antibody was raised using the middle region of AASDH corresponding to a region with amino acids TDGKVWILESQSGQLQSVYELPGEVFSSPVVLESMLIIGCRDNYVYCLDL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AASDH Blocking Peptide, (ABIN5611848), is also available for use as a blocking control in assays to test for specificity of this AASDH antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AASDH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AASDH

Antigène: AASDH (Aminoadipate-Semialdehyde Dehydrogenase (AASDH))

Autre désignation: AASDH

Sujet: Acyl-CoA synthases catalyze the initial reaction in fatty acid metabolism, by forming a thioester with CoA.

Poids moléculaire: 122 kDa (MW of target protein)