CCDC38 anticorps (N-Term)

N° du produit ABIN631855

Cet anticorps Lapin Polyclonal détecte spécifiquement CCDC38 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour CCDC38 anticorps (N-Term) (ABIN631855)

Antigène: CCDC38 (Coiled-Coil Domain Containing 38 (CCDC38))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CCDC38 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CCDC38 anticorps

Épitope: N-Term

Specificité: CCDC38 antibody was raised against the N terminal of CCDC38

Purification: Affinity purified

Immunogène: CCDC38 antibody was raised using the N terminal of CCDC38 corresponding to a region with amino acids RERQLKKAEKKLQDDALAFEEFLRENDQRSVDALKMAAQETINKLQMTAE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CCDC38 Blocking Peptide, (ABIN5612709), is also available for use as a blocking control in assays to test for specificity of this CCDC38 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC38 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CCDC38

Antigène: CCDC38 (Coiled-Coil Domain Containing 38 (CCDC38))

Autre désignation: CCDC38

Sujet: The specific function of CCDC38 is not yet known.

Poids moléculaire: 65 kDa (MW of target protein)