FAM83B anticorps (C-Term)

N° du produit ABIN631856

L’anticorps Lapin Polyclonal anti-FAM83B a été validé pour WB. Il convient pour détecter FAM83B dans des échantillons de Humain.

Aperçu rapide pour FAM83B anticorps (C-Term) (ABIN631856)

Antigène: FAM83B (Family with Sequence Similarity 83, Member B (FAM83B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM83B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FAM83B anticorps

Épitope: C-Term

Specificité: FAM83 B antibody was raised against the C terminal of FAM83

Purification: Affinity purified

Immunogène: FAM83 B antibody was raised using the C terminal of FAM83 corresponding to a region with amino acids PRRKHSSSSNSQGSIHKSKEDVTVSPSQEINAPPDENKRTPSPGPVESKF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM83B Blocking Peptide, (ABIN5613509), is also available for use as a blocking control in assays to test for specificity of this FAM83B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM83B

Antigène: FAM83B (Family with Sequence Similarity 83, Member B (FAM83B))

Autre désignation: FAM83B

Sujet: The function of FAM83B protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 115 kDa (MW of target protein)