DPPA4 anticorps (N-Term)

N° du produit ABIN631866

Cet anticorps anti-DPPA4 est un anticorps Polyclonal produit chez le Lapin, détectant DPPA4 dans WB. Convient pour Humain.

Aperçu rapide pour DPPA4 anticorps (N-Term) (ABIN631866)

Antigène: DPPA4 (Developmental Pluripotency Associated 4 (DPPA4))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DPPA4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DPPA4 anticorps

Épitope: N-Term

Specificité: DPPA4 antibody was raised against the N terminal of DPPA4

Purification: Affinity purified

Immunogène: DPPA4 antibody was raised using the N terminal of DPPA4 corresponding to a region with amino acids MLRGSASSTSMEKAKGKEWTSTEKSREEDQQASNQPNSIALPGTSAKRTK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DPPA4 Blocking Peptide, (ABIN5613251), is also available for use as a blocking control in assays to test for specificity of this DPPA4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPPA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DPPA4

Antigène: DPPA4 (Developmental Pluripotency Associated 4 (DPPA4))

Autre désignation: DPPA4

Sujet: DPPA4 may play a role in maintaining cell pluripotentiality.

Poids moléculaire: 33 kDa (MW of target protein)