C1orf55 anticorps (C-Term)

N° du produit ABIN631867

Détail du produit anti-C1orf55 anticorps

Antigène: C1orf55 (Chromosome 1 Open Reading Frame 55 (C1orf55))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C1orf55 est non-conjugé

Application: Western Blotting (WB)

Specificité: C1 ORF55 antibody was raised against the C terminal Of C1 rf55

Purification: Affinity purified

Immunogène: C1 ORF55 antibody was raised using the C terminal Of C1 rf55 corresponding to a region with amino acids AFTSVAELELLGLEKLKCELMALGLKCGGTLQERAARLFSVRGLAKEQID

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C1ORF55 Blocking Peptide, catalog no. 33R-1180, is also available for use as a blocking control in assays to test for specificity of this C1ORF55 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF55 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C1orf55

Antigène: C1orf55 (Chromosome 1 Open Reading Frame 55 (C1orf55))

Autre désignation: C1ORF55 (C1orf55 Produits)

Synonymes: anticorps C1orf55, anticorps RP4-671D7.1, anticorps dJ671D7.1, anticorps SDE2, anticorps c1orf55, anticorps DKFZp469F1217, anticorps RGD1305572, anticorps wu:fb55e02, anticorps wu:fi34c02, anticorps zgc:112095, anticorps SDE2 telomere maintenance homolog, anticorps SDE2 telomere maintenance homolog (S. pombe) S homeolog, anticorps SDE2 telomere maintenance homolog (S. pombe), anticorps SDE2, anticorps sde2.S, anticorps sde2, anticorps Sde2

Sujet: C1orf55 is phosphorylated upon DNA damage, probably by ATM or ATR. The exact function of C1orf55 remains unknown.

Poids moléculaire: 50 kDa (MW of target protein)