OSCP1 anticorps (N-Term)

N° du produit ABIN631871

L’anticorps Lapin Polyclonal anti-OSCP1 a été validé pour WB. Il convient pour détecter OSCP1 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour OSCP1 anticorps (N-Term) (ABIN631871)

Antigène: OSCP1 (Organic Solute Carrier Partner 1 (OSCP1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OSCP1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-OSCP1 anticorps

Épitope: N-Term

Specificité: C1 ORF102 antibody was raised against the N terminal Of C1 rf102

Purification: Affinity purified

Immunogène: C1 ORF102 antibody was raised using the N terminal Of C1 rf102 corresponding to a region with amino acids MSVRTLPLLFLNLGGEMLYILDQRLRAQNIPGDKARKDEWTEVDRKRVLN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C1ORF102 Blocking Peptide, (ABIN5612449), is also available for use as a blocking control in assays to test for specificity of this C1ORF102 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF102 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OSCP1

Antigène: OSCP1 (Organic Solute Carrier Partner 1 (OSCP1))

Autre désignation: C1ORF102

Sujet: C1ORF102 may be involved in drug clearance in the placenta.

Poids moléculaire: 43 kDa (MW of target protein)