CCDC54 anticorps (N-Term)

N° du produit ABIN631876

Cet anticorps Lapin Polyclonal détecte spécifiquement CCDC54 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour CCDC54 anticorps (N-Term) (ABIN631876)

Antigène: CCDC54 (Coiled-Coil Domain Containing 54 (CCDC54))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CCDC54 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CCDC54 anticorps

Épitope: N-Term

Specificité: CCDC54 antibody was raised against the N terminal of CCDC54

Purification: Affinity purified

Immunogène: CCDC54 antibody was raised using the N terminal of CCDC54 corresponding to a region with amino acids MPFGCVTLGDKKNYNQPSEVTDRYDLGQVIKTEEFCEIFRAKDKTTGKLH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CCDC54 Blocking Peptide, (ABIN5612711), is also available for use as a blocking control in assays to test for specificity of this CCDC54 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC54 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CCDC54

Antigène: CCDC54 (Coiled-Coil Domain Containing 54 (CCDC54))

Autre désignation: CCDC54

Sujet: The specific function of CCDC54 is not yet known.

Poids moléculaire: 36 kDa (MW of target protein)