Nop10 anticorps (Middle Region)

N° du produit ABIN631878

Détail du produit anti-Nop10 anticorps

Antigène: Nop10 (NOP10 Ribonucleoprotein Homolog (Nop10))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Nop10 est non-conjugé

Application: Western Blotting (WB)

Specificité: NOLA3 antibody was raised against the middle region of Nola3

Purification: Affinity purified

Immunogène: NOLA3 antibody was raised using the middle region of Nola3 corresponding to a region with amino acids MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NOLA3 Blocking Peptide, catalog no. 33R-5997, is also available for use as a blocking control in assays to test for specificity of this NOLA3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOLA3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Nop10

Antigène: Nop10 (NOP10 Ribonucleoprotein Homolog (Nop10))

Autre désignation: NOLA3 (Nop10 Produits)

Synonymes: anticorps DKCB1, anticorps NOLA3, anticorps NOP10P, anticorps 1110036B12Rik, anticorps Nola3, anticorps nola3, anticorps zgc:109956, anticorps NOP10 ribonucleoprotein, anticorps NOP10 ribonucleoprotein homolog (yeast), anticorps NOP10, anticorps Nop10, anticorps nop10

Sujet: This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA.

Poids moléculaire: 8 kDa (MW of target protein)