WDR55 anticorps (Middle Region)

N° du produit ABIN631883

L’anticorps Lapin Polyclonal anti-WDR55 a été validé pour WB. Il convient pour détecter WDR55 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour WDR55 anticorps (Middle Region) (ABIN631883)

Antigène: WDR55 (WD Repeat Domain 55 (WDR55))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WDR55 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-WDR55 anticorps

Épitope: Middle Region

Specificité: WDR55 antibody was raised against the middle region of WDR55

Purification: Affinity purified

Immunogène: WDR55 antibody was raised using the middle region of WDR55 corresponding to a region with amino acids AKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLTSVTLMKWGKKVACG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WDR55 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this WDR55 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR55 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WDR55

Antigène: WDR55 (WD Repeat Domain 55 (WDR55))

Autre désignation: WDR55

Sujet: WDR55 is a nucleolar protein that acts as a modulator of rRNA synthesis. WDR55 plays a central role during organogenesis.

Poids moléculaire: 42 kDa (MW of target protein)