RPL10A anticorps (N-Term)

N° du produit ABIN631884

Cet anticorps anti-RPL10A est un anticorps Lapin Polyclonal détectant RPL10A dans WB. Adapté pour Humain.

Aperçu rapide pour RPL10A anticorps (N-Term) (ABIN631884)

Antigène: RPL10A (Ribosomal Protein L10a (RPL10A))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPL10A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RPL10A anticorps

Épitope: N-Term

Specificité: RPL10 A antibody was raised against the N terminal of RPL10

Purification: Affinity purified

Immunogène: RPL10 A antibody was raised using the N terminal of RPL10 corresponding to a region with amino acids MSSKVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQKDKRFS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPL10A Blocking Peptide, (ABIN5615935), is also available for use as a blocking control in assays to test for specificity of this RPL10A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPL10A

Antigène: RPL10A (Ribosomal Protein L10a (RPL10A))

Autre désignation: RPL10A

Sujet: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L1P family of ribosomal proteins. It is located in the cytoplasm. The expression of this gene is downregulated in the thymus by cyclosporin-A (CsA), an immunosuppressive drug. Studies in mice have shown that the expression of the ribosomal protein L10a gene is downregulated in neural precursor cells during development.

Poids moléculaire: 25 kDa (MW of target protein)