RPL10A anticorps (N-Term)
-
- Antigène Voir toutes RPL10A Anticorps
- RPL10A (Ribosomal Protein L10a (RPL10A))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RPL10A est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RPL10 A antibody was raised against the N terminal of RPL10
- Purification
- Affinity purified
- Immunogène
- RPL10 A antibody was raised using the N terminal of RPL10 corresponding to a region with amino acids MSSKVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQKDKRFS
- Top Product
- Discover our top product RPL10A Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RPL10A Blocking Peptide, catalog no. 33R-6498, is also available for use as a blocking control in assays to test for specificity of this RPL10A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RPL10A (Ribosomal Protein L10a (RPL10A))
- Autre désignation
- RPL10A (RPL10A Produits)
- Synonymes
- anticorps Csa-19, anticorps L10A, anticorps NEDD6, anticorps CsA-19, anticorps Nedd6, anticorps wu:fb94f08, anticorps zgc:73082, anticorps zgc:86881, anticorps ribosomal protein L10a, anticorps ribosomal protein L10A, anticorps ribosomal protein L10a S homeolog, anticorps RPL10A, anticorps Rpl10a, anticorps rpl10a, anticorps rpl10a.S
- Sujet
- Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L1P family of ribosomal proteins. It is located in the cytoplasm. The expression of this gene is downregulated in the thymus by cyclosporin-A (CsA), an immunosuppressive drug. Studies in mice have shown that the expression of the ribosomal protein L10a gene is downregulated in neural precursor cells during development.
- Poids moléculaire
- 25 kDa (MW of target protein)
-