PGLS anticorps (Middle Region)
-
- Antigène Voir toutes PGLS Anticorps
- PGLS (6-phosphogluconolactonase (PGLS))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PGLS est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PGLS antibody was raised against the middle region of PGLS
- Purification
- Affinity purified
- Immunogène
- PGLS antibody was raised using the middle region of PGLS corresponding to a region with amino acids AAVLKRILEDQEENPLPAALVQPHTGKLCWFLDEAAARLLTVPFEKHSTL
- Top Product
- Discover our top product PGLS Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PGLS Blocking Peptide, catalog no. 33R-1059, is also available for use as a blocking control in assays to test for specificity of this PGLS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGLS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PGLS (6-phosphogluconolactonase (PGLS))
- Autre désignation
- PGLS (PGLS Produits)
- Synonymes
- anticorps 6PGL, anticorps PGLS, anticorps PSPTO1301, anticorps 1110030K05Rik, anticorps AI447866, anticorps Plgs, anticorps 6-phosphogluconolactonase, anticorps PGLS, anticorps pgl, anticorps CND03390, anticorps CNE04030, anticorps Tb11.02.4200, anticorps Pgls
- Sujet
- PGLS belongs to the glucosamine/galactosamine-6-phosphate isomerase family, 6-phosphogluconolactonase subfamily. It is implicated in the hydrolysis of 6-phosphogluconolactone to 6-phosphogluconate.
- Poids moléculaire
- 28 kDa (MW of target protein)
-