PGLS anticorps (Middle Region)

N° du produit ABIN631885

Détail du produit anti-PGLS anticorps

Antigène: PGLS (6-phosphogluconolactonase (PGLS))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PGLS est non-conjugé

Application: Western Blotting (WB)

Specificité: PGLS antibody was raised against the middle region of PGLS

Purification: Affinity purified

Immunogène: PGLS antibody was raised using the middle region of PGLS corresponding to a region with amino acids AAVLKRILEDQEENPLPAALVQPHTGKLCWFLDEAAARLLTVPFEKHSTL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PGLS Blocking Peptide, catalog no. 33R-1059, is also available for use as a blocking control in assays to test for specificity of this PGLS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGLS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PGLS

Antigène: PGLS (6-phosphogluconolactonase (PGLS))

Autre désignation: PGLS (PGLS Produits)

Synonymes: anticorps 6PGL, anticorps PGLS, anticorps PSPTO1301, anticorps 1110030K05Rik, anticorps AI447866, anticorps Plgs, anticorps 6-phosphogluconolactonase, anticorps PGLS, anticorps pgl, anticorps CND03390, anticorps CNE04030, anticorps Tb11.02.4200, anticorps Pgls

Sujet: PGLS belongs to the glucosamine/galactosamine-6-phosphate isomerase family, 6-phosphogluconolactonase subfamily. It is implicated in the hydrolysis of 6-phosphogluconolactone to 6-phosphogluconate.

Poids moléculaire: 28 kDa (MW of target protein)