C19orf47 anticorps (C-Term)

N° du produit ABIN631889

L’anticorps Lapin Polyclonal anti-C19orf47 a été validé pour WB. Il convient pour détecter C19orf47 dans des échantillons de Humain et Souris.

Aperçu rapide pour C19orf47 anticorps (C-Term) (ABIN631889)

Antigène: C19orf47 (Chromosome 19 Open Reading Frame 47 (C19orf47))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C19orf47 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-C19orf47 anticorps

Épitope: C-Term

Specificité: C19 ORF47 antibody was raised against the C terminal Of C19 rf47

Purification: Affinity purified

Immunogène: C19 ORF47 antibody was raised using the C terminal Of C19 rf47 corresponding to a region with amino acids DSQVTSTKSKSSAEVKVTIKRTLVGPRGSSSSEGLGAQMDHAGTVSVFKR

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C19ORF47 Blocking Peptide, (ABIN937562), is also available for use as a blocking control in assays to test for specificity of this C19ORF47 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF47 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C19orf47

Antigène: C19orf47 (Chromosome 19 Open Reading Frame 47 (C19orf47))

Autre désignation: C19ORF47

Sujet: The function of Chromosome 19 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 38 kDa (MW of target protein)