PAOX anticorps

N° du produit ABIN631893

Cet anticorps anti-PAOX Polyclonal Lapin (ABIN631893) détecte spécifiquement PAOX dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour PAOX anticorps (ABIN631893)

Antigène: PAOX (Polyamine Oxidase (Exo-N4-Amino) (PAOX))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PAOX est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PAOX anticorps

Purification: Affinity purified

Immunogène: PAOX antibody was raised using a synthetic peptide corresponding to a region with amino acids HSAFPHLRVLEATARAGGRIRSERCFGGVVEVGAHWIHGPSRGNPVFQLA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PAOX Blocking Peptide, (ABIN939236), is also available for use as a blocking control in assays to test for specificity of this PAOX antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAOX antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PAOX

Antigène: PAOX (Polyamine Oxidase (Exo-N4-Amino) (PAOX))

Autre désignation: PAOX

Sujet: PAOX belongs to the flavin monoamine oxidase family. PAOX is a flavoenzyme which catalyzes the oxidation of N(1)-acetylspermine to spermidine and is thus involved in the polyamine back-conversion. It can also oxidize N(1)-acetylspermidine to putrescine.

Poids moléculaire: 56 kDa (MW of target protein)