MAGEA3 anticorps (Middle Region)

N° du produit ABIN631907

L’anticorps Lapin Polyclonal anti-MAGEA3 a été validé pour WB. Il convient pour détecter MAGEA3 dans des échantillons de Humain.

Aperçu rapide pour MAGEA3 anticorps (Middle Region) (ABIN631907)

Antigène: MAGEA3 (Melanoma Antigen Family A, 3 (MAGEA3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAGEA3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MAGEA3 anticorps

Épitope: Middle Region

Specificité: MAGEA3 antibody was raised against the middle region of MAGEA3

Purification: Affinity purified

Immunogène: MAGEA3 antibody was raised using the middle region of MAGEA3 corresponding to a region with amino acids APEEKIWEELSVLEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAGEA3 Blocking Peptide, (ABIN936806), is also available for use as a blocking control in assays to test for specificity of this MAGEA3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEA3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAGEA3

Antigène: MAGEA3 (Melanoma Antigen Family A, 3 (MAGEA3))

Autre désignation: MAGEA3

Sujet: MAGEA3 is a member of the MAGEA family. The members of this family have 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita.

Poids moléculaire: 35 kDa (MW of target protein)