Pellino 3 anticorps

N° du produit ABIN631913

L’anticorps anti-Pellino 3 Polyclonal Lapin est utilisé pour la détection de Pellino 3 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour Pellino 3 anticorps (ABIN631913)

Antigène: Pellino 3 (PELI3) (Pellino E3 Ubiquitin Protein Ligase Family Member 3 (PELI3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Pellino 3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Pellino 3 anticorps

Purification: Affinity purified

Immunogène: PELI3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLEGNPEVGSPRTSDLQHRGNKGSCVLSSPGEDAQPGEEPIKYGELIVLG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PELI3 Blocking Peptide, (ABIN5615306), is also available for use as a blocking control in assays to test for specificity of this PELI3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PELI3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Pellino 3

Antigène: Pellino 3 (PELI3) (Pellino E3 Ubiquitin Protein Ligase Family Member 3 (PELI3))

Autre désignation: PELI3

Sujet: Toll-like receptors (TLRs) and IL1R (IL1R1) are part of the innate immune response aimed at mobilizing defense mechanisms in response in infection or injury. Pellino proteins, such as PELI3, are intermediate components in the signaling cascades initiated by TLRs and IL1R.

Poids moléculaire: 48 kDa (MW of target protein)

Pathways: Toll-Like Receptors Cascades