HMBS anticorps (N-Term)

N° du produit ABIN631916

L’anticorps Lapin Polyclonal anti-HMBS a été validé pour WB. Il convient pour détecter HMBS dans des échantillons de Humain.

Aperçu rapide pour HMBS anticorps (N-Term) (ABIN631916)

Antigène: HMBS (Hydroxymethylbilane Synthase (HMBS))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HMBS est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HMBS anticorps

Épitope: N-Term

Specificité: HMBS antibody was raised against the N terminal of HMBS

Purification: Affinity purified

Immunogène: HMBS antibody was raised using the N terminal of HMBS corresponding to a region with amino acids MRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDTA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HMBS Blocking Peptide, (ABIN5614024), is also available for use as a blocking control in assays to test for specificity of this HMBS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HMBS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HMBS

Antigène: HMBS (Hydroxymethylbilane Synthase (HMBS))

Autre désignation: HMBS

Sujet: HMBS is a member of the hydroxymethylbilane synthase superfamily. It is the third enzyme of the heme biosynthetic pathway and catalyzes the head to tail condensation of four porphobilinogen molecules into the linear hydroxymethylbilane. Mutations in this gene are associated with the autosomal dominant disease acute intermittent porphyria.

Poids moléculaire: 38 kDa (MW of target protein)