HMBS anticorps (N-Term)

N° du produit ABIN631916

Détail du produit anti-HMBS anticorps

Antigène: HMBS (Hydroxymethylbilane Synthase (HMBS))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HMBS est non-conjugé

Application: Western Blotting (WB)

Specificité: HMBS antibody was raised against the N terminal of HMBS

Purification: Affinity purified

Immunogène: HMBS antibody was raised using the N terminal of HMBS corresponding to a region with amino acids MRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDTA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HMBS Blocking Peptide, catalog no. 33R-6388, is also available for use as a blocking control in assays to test for specificity of this HMBS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HMBS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HMBS

Antigène: HMBS (Hydroxymethylbilane Synthase (HMBS))

Autre désignation: HMBS (HMBS Produits)

Synonymes: anticorps PBG-D, anticorps PBGD, anticorps PORC, anticorps UPS, anticorps URO-S, anticorps hemC, anticorps pbg-d, anticorps pbgd, anticorps ups, anticorps SPAC806.01, anticorps DDBDRAFT_0186148, anticorps DDBDRAFT_0231417, anticorps DDB_0186148, anticorps DDB_0231417, anticorps Hmbs, anticorps NV50236, anticorps T25658, anticorps Ups, anticorps Uros1, anticorps hmbs, anticorps zgc:64128, anticorps hmbsl, anticorps id:ibd5004, anticorps im:7140060, anticorps zgc:110690, anticorps hydroxymethylbilane synthase, anticorps hydroxymethylbilane synthase S homeolog, anticorps hydroxymethylbilane synthase L homeolog, anticorps hydroxymethylbilane synthase (predicted), anticorps Hydroxymethylbilane synthase, anticorps hydroxymethylbilane synthase a, anticorps hydroxymethylbilane synthase, b, anticorps HMBS, anticorps Hmbs, anticorps hmbs, anticorps hmbs.2.S, anticorps hmbs.L, anticorps CNC02250, anticorps hem3, anticorps hemC, anticorps Trad_0335, anticorps Plabr_2100, anticorps Sgly_3113, anticorps SMLT_RS19660, anticorps PMI_RS16580, anticorps hmbsa, anticorps hmbsb

Sujet: HMBS is a member of the hydroxymethylbilane synthase superfamily. It is the third enzyme of the heme biosynthetic pathway and catalyzes the head to tail condensation of four porphobilinogen molecules into the linear hydroxymethylbilane. Mutations in this gene are associated with the autosomal dominant disease acute intermittent porphyria.

Poids moléculaire: 38 kDa (MW of target protein)