METTL5 anticorps (N-Term)

N° du produit ABIN631925

Détail du produit anti-METTL5 anticorps

Antigène: METTL5 (Methyltransferase Like 5 (METTL5))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp METTL5 est non-conjugé

Application: Western Blotting (WB)

Specificité: METTL5 antibody was raised against the N terminal of METTL5

Purification: Affinity purified

Immunogène: METTL5 antibody was raised using the N terminal of METTL5 corresponding to a region with amino acids KKVRLKELESRLQQVDGFEKPKLLLEQYPTRPHIAACMLYTIHNTYDDIE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

METTL5 Blocking Peptide, catalog no. 33R-4497, is also available for use as a blocking control in assays to test for specificity of this METTL5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METTL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur METTL5

Antigène: METTL5 (Methyltransferase Like 5 (METTL5))

Autre désignation: METTL5 (METTL5 Produits)

Synonymes: anticorps im:7137598, anticorps zgc:103655, anticorps HSPC133, anticorps 2810410A08Rik, anticorps RGD1566062, anticorps methyltransferase like 5, anticorps mettl5, anticorps METTL5, anticorps Mettl5

Sujet: METTL5 is a probable methyltransferase.

Poids moléculaire: 24 kDa (MW of target protein)