ENOSF1 anticorps (N-Term)

N° du produit ABIN631927

Détail du produit anti-ENOSF1 anticorps

Antigène: ENOSF1 (Enolase Superfamily Member 1 (ENOSF1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ENOSF1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ENOSF1 antibody was raised against the N terminal of ENOSF1

Purification: Affinity purified

Immunogène: ENOSF1 antibody was raised using the N terminal of ENOSF1 corresponding to a region with amino acids MVRGRISRLSVRDVRFPTSLGGHGADAMHTDPDYSAAYVVIETDAEDGIK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ENOSF1 Blocking Peptide, catalog no. 33R-6601, is also available for use as a blocking control in assays to test for specificity of this ENOSF1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENOSF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ENOSF1

Antigène: ENOSF1 (Enolase Superfamily Member 1 (ENOSF1))

Autre désignation: ENOSF1 (ENOSF1 Produits)

Synonymes: anticorps HSRTSBETA, anticorps RTS, anticorps TYMSAS, anticorps enolase superfamily member 1, anticorps enolase superfamily member 1 S homeolog, anticorps ENOSF1, anticorps enosf1.S

Sujet: This gene was originally identified as a naturally occurring antisense transcript to the human thymidylate synthase gene. Alternate splice variants have been described.

Poids moléculaire: 50 kDa (MW of target protein)