ZCCHC24 anticorps (Middle Region)

N° du produit ABIN631945

Détail du produit anti-ZCCHC24 anticorps

Antigène: ZCCHC24 (Zinc Finger, CCHC Domain Containing 24 (ZCCHC24))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZCCHC24 est non-conjugé

Application: Western Blotting (WB)

Specificité: C10 ORF56 antibody was raised against the middle region of C10 rf56

Purification: Affinity purified

Immunogène: C10 ORF56 antibody was raised using the middle region of C10 rf56 corresponding to a region with amino acids LTEHFSDLTLTSEARKPSKRPPPNYLCHLCFNKGHYIKDCPQARPKGEGL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C10ORF56 Blocking Peptide, catalog no. 33R-5470, is also available for use as a blocking control in assays to test for specificity of this C10ORF56 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF56 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ZCCHC24

Antigène: ZCCHC24 (Zinc Finger, CCHC Domain Containing 24 (ZCCHC24))

Autre désignation: C10ORF56 (ZCCHC24 Produits)

Synonymes: anticorps RGD1306164, anticorps fc45d05, anticorps wu:fc45d05, anticorps zgc:158323, anticorps C10orf56, anticorps 2310047A01Rik, anticorps zinc finger CCHC-type containing 24, anticorps zinc finger, CCHC domain containing 24, anticorps Zcchc24, anticorps ZCCHC24, anticorps zcchc24

Sujet: C10orf56 is probably involved in oxidoreductase activity.

Poids moléculaire: 27 kDa (MW of target protein)